PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn019631
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Nin-like
Protein Properties Length: 940aa    MW: 104593 Da    PI: 6.1147
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn019631genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK87.98.3e-28619669252
      RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 ek+isl++l++yFs+++kdAAk+Lgvc+T+LKriCR +GI RWP+Rk+k++
  Achn019631 619 EKSISLQVLRQYFSGSLKDAAKSLGVCPTTLKRICRLHGITRWPSRKLKKV 669
                 89***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.984608689IPR003035RWP-RK domain
PfamPF020421.3E-24622669IPR003035RWP-RK domain
SuperFamilySSF542772.45E-23839927No hitNo description
Gene3DG3DSA:3.10.20.2403.5E-25839922No hitNo description
PROSITE profilePS5174521.472841924IPR000270PB1 domain
SMARTSM006662.3E-26841924IPR000270PB1 domain
PfamPF005641.1E-18842922IPR000270PB1 domain
CDDcd064073.45E-40842923No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 940 aa     Download sequence    Send to blast
MEDGSFTPNT LLETLSDNTM DFDLMDELFY DGYWLETTEG PNFWQSGLST SDDLNFSSYS  60
GPTSEPNTVH LNPNPHHKSH QEQAEISDLS NNLHLVCPQM DELVGSQTQN REVILVAATS  120
GQSETFLVES SETNRRLWIP PSEDASRSYP VKKRLMQAIE HLRQSTSDRD VLIQIWVPIT  180
RGGKQFLTTN NQPFALNPNC KNLAAYRSVS MGYQFATEEN SKDFVGLPGR VFLTELPEWT  240
PDVRFFRREE YPRVKYAQQL DVMGSLALPV FEQGSGTCLG VVEMVTTSQK AKYRPELESV  300
CKALEACDDS YQAALTEIQE VLKSVCDTNG LPLAQTWAPC IQHGKAGCRH SSENYAACVS  360
TVDSAWYVRN QQVLEFHEAC SEHHLLRGEG VAGGAFMTNR VCFSNDITTL SKIRYPLSHH  420
ARLFGLRAAI AIRLRSIYAE SADFVLEFFL TSDFQNTGEQ GNVLSSLSSA IHQVCRSLRL  480
VTDQELEEET AFQERVIVAP SDGSLDEDHA QILGYSLSKE SSQKESSWIA DMMEAQRKGK  540
TVSVSLGYRK EEPKKDFKET WDIDGMDLYR RNAFSEHKQI YQDSGPKGNA ESGGDFSSVS  600
RHSLSGVRKA GERRRTKSEK SISLQVLRQY FSGSLKDAAK SLGVCPTTLK RICRLHGITR  660
WPSRKLKKVG HSLKKLQLII DSVQGVEGSF QLSSFYSNFP DLSSPNLPGT SPVSTSNIND  720
QLKQFNTQPK GSLLSPVTTT SKSPSSSCSH SSTSSFYCST ETKQPPATVH ALGGGDSLLE  780
EHPGGILKRA HSDAELHDAG QEETKLLVRS HSHKFFSELP SSEALPSLPK VGGQVFRDGS  840
GFRVKATFGE EKIRFSIQQN WGFGDLQQEI VKRFNIDENN KINLKYLDDD SEWVLLTCDA  900
DLEECMDIHR SSRSRTIKLS VYQAINPNFG SSFGSSGPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010645880.10.0PREDICTED: protein NLP2-like
RefseqXP_010645886.10.0PREDICTED: protein NLP2-like
RefseqXP_010645896.10.0PREDICTED: protein NLP2-like
RefseqXP_010645900.10.0PREDICTED: protein NLP2-like
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLF6I0S70.0F6I0S7_VITVI; Putative uncharacterized protein
STRINGVIT_03s0038g03710.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15982467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein